SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428216779|ref|YP_007101244.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428216779|ref|YP_007101244.1|
Domain Number - Region: 45-107,138-202
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.000143
Family PDEase 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428216779|ref|YP_007101244.1|
Sequence length 314
Comment hypothetical protein Pse7367_0508 [Pseudanabaena sp. PCC 7367]
Sequence
MFNPTKLLIEDCARSLKEGYYSTYGGLKPDYADIIAWAGSMALENIANSNALYHDVEHTI
FVTLVGLEILRGKHIREGGVSTEDWLHFMISLLCHDIGYVRGVCRQDQISKHLYATGNGE
MLVELPLSATDASLTPYHVDRGKLFIQERFGGHRLIKADVIKTNIELTRFPVPLDSDHQD
TVNYPGLVRAADLIGQLSDPRYLQKIPALYYEFEETGVNNQLGYENPEDLRQNYPKFYWS
VVFPYIAHAADYLRLTQEGKQILANLYAHVFEVEHDPNVRNVRADPAAVSSVSPVPPPVP
PMSSIHAPELEQAN
Download sequence
Identical sequences K9SFT5
gi|428216779|ref|YP_007101244.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]