SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428216848|ref|YP_007101313.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428216848|ref|YP_007101313.1|
Domain Number 1 Region: 2-314
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.42e-43
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0046
Further Details:      
 
Weak hits

Sequence:  gi|428216848|ref|YP_007101313.1|
Domain Number - Region: 330-417
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00687
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428216848|ref|YP_007101313.1|
Sequence length 440
Comment ferredoxin--NAD(+) reductase [Pseudanabaena sp. PCC 7367]
Sequence
MQKHYFIIGAGVAGITAAEQLRRGDAEASITVINGEDYPFYRRLSLSTYLQGQTTLEALT
VKQPEDYEALNVTVLQDRVAQIKPNENTLVMASGETHNYDGLIIATGGSAIKPPIPGIDL
NGVRLGYWDMKDTLWYEEIAKANNGNDAVVIGGGVLGLELADCFNQAGLKVTIVQLGATL
GEPLTDEVSGEILLNRVKESGAECRIGVMAKEILGDENGNVRAVVTSAGEEIPAKAVGIC
IGIRPNVAFLQDSGIELVNGCIGVDGYLKTNFDNIFAAGDCTWVSSGNMVGYRPNRTWQV
ATNQGTIAAMNLQGMQHPYDEGLFYNAGVLYDLPYTMLGNFNPDPNDESCQVHTYDTAGD
PFAHFKLTVSEGRLVGAMLLGRQRRTNILRKIMEGNFIITGHEHELMDKKFKPKDLPVAD
IQTAGDADVEAKLAAYASKG
Download sequence
Identical sequences K9SFG8
WP_015163859.1.5078 gi|428216848|ref|YP_007101313.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]