SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428216997|ref|YP_007101462.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428216997|ref|YP_007101462.1|
Domain Number 1 Region: 4-69
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000000303
Family 7-Fe ferredoxin 0.0000704
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428216997|ref|YP_007101462.1|
Sequence length 81
Comment Photosystem I iron-sulfur center [Pseudanabaena sp. PCC 7367]
Sequence
MSHAVKIYDTCIGCTQCVRACPCDVLEMVPWDGCKANQIASSPRTEDCIGCKRCETACPT
DFLSIRVYLGAETTRSMGLTY
Download sequence
Identical sequences K9SGW7
WP_015164008.1.5078 gi|428216997|ref|YP_007101462.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]