SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428217275|ref|YP_007101740.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428217275|ref|YP_007101740.1|
Domain Number 1 Region: 34-239
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.27e-39
Family FkbM-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428217275|ref|YP_007101740.1|
Sequence length 278
Comment FkbM family methyltransferase [Pseudanabaena sp. PCC 7367]
Sequence
MPTPLDYLRHQPFFVKYIQPRLDITFAAKMQDIDWRVYVRLVRNITWVYKSGNVAPTLKA
LFLAIDQTFQPKVFWDVGANIGYFSWLLLSHSKELEAVLFEPDLDNINLLRKTIAQADFL
QSRVQLITSAVSDRQGKASFAIDAITGATGSIDDSRPTFVQMYYDADPSFTTVDTVSLDQ
LWQQQRAGTPDLIKIDIEGSEDKAIAGAWELIEACQPILVIECMHREIIEQLAQRGYHIL
DAGNPQRSIKPGIDLLAIPDRHVDAIDNLCTNWQEILT
Download sequence
Identical sequences K9SFD3
WP_015164285.1.5078 gi|428217275|ref|YP_007101740.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]