SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428217542|ref|YP_007102007.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428217542|ref|YP_007102007.1|
Domain Number 1 Region: 379-579
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.01e-31
Family TK-like Pyr module 0.03
Further Details:      
 
Domain Number 2 Region: 59-337
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.93e-31
Family TK-like PP module 0.006
Further Details:      
 
Domain Number 3 Region: 585-735
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000000451
Family Transketolase C-terminal domain-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428217542|ref|YP_007102007.1|
Sequence length 736
Comment transketolase [Pseudanabaena sp. PCC 7367]
Sequence
MVITADAIKSLPTFCEGIQYFGEPIDGFEVLGKSPLIQPGQKAIADPNAEAAVFQTMLAA
DALRYLTLQVTASKSSGHPGGFASSVEAFASLFMLGHKNIPTEVGHHAPGFYSAMFLDRS
LEQMDIHNVAQMRERFRELHGLLGHLSGYIPGILSPAGPLGQGQHFAMAAAWLHRDKLIP
FTMGDGGMGEPYPMSAIAHFNTSFPEVTNFLPVLVWNGFSQEHHSMVSTKTNEEMLAYWR
GNGFAEVILIDAKDFDDQDQSGAYVDSTMFSLGQRLAFTQAVLNGCDRAAKSALSGKLTV
FIIKQLKGAGVHARGAKSHNLYAYHNLENQEIVDALQSLALSPEAWQTVRTNFENAGGGP
AAQTAVTESVLPIAELGELPLEEYEVGGDRKVATTAMGQLVAAVGQSDPNYIVTNADGNE
ASGIKNINVALRINHPTTDDLYNQSPGGQVYEPLSEDACAGFAAGLALMGSRTLWCSYES
FAVNGLPIWQTVTQAMAELRRPTPSTVTLYTAGALEQGRNGWTHQRPEIEAYFAAMMRNG
NIFPLFPTDANSIQVCYDWALTTKNKGITITASKTPLPIHTTFAQSRQALQDGAILLQEI
LGSKTVVLATIGDMVLIPVLEAAKALQEQGIGSKIVSVVSPRRLYRVHDTAWETCSEPDG
GFLDEARFEKLFGGDALLGITGGASGMLEPIMLRSNLKRDTFAWKRGETTSAAGVLMGLN
GITAEAIAKRAMELLA
Download sequence
Identical sequences K9SIF0
WP_015164552.1.5078 gi|428217542|ref|YP_007102007.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]