SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428217676|ref|YP_007102141.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428217676|ref|YP_007102141.1|
Domain Number 1 Region: 55-174
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000114
Family Retroviral integrase, catalytic domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428217676|ref|YP_007102141.1|
Sequence length 195
Comment transposase [Pseudanabaena sp. PCC 7367]
Sequence
MINNWLKSHQPEIQNGQIRVFALDECHTRAGDICGYGWGDRQQRLEVKVDNYRDSQTYFG
ALDCLNGDLILQSYQSANSSSTIEFVKHLHDISAGAKILLVWDGASYHRSQAFRDFLTQI
NQGQDWQIHCLRFAPYAPAENPIENIWGQAKQVLRQMHQFCRSFKLTKKLFELFLRYRLF
TLPDLSTYSAFSNII
Download sequence
Identical sequences K9SHN4
gi|428217167|ref|YP_007101632.1| gi|428217676|ref|YP_007102141.1| WP_015164177.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]