SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428217985|ref|YP_007102450.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428217985|ref|YP_007102450.1|
Domain Number 1 Region: 245-295,334-577
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.88e-29
Family Tandem AAA-ATPase domain 0.048
Further Details:      
 
Domain Number 2 Region: 20-114,169-181
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.0000000785
Family MioX-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428217985|ref|YP_007102450.1|
Sequence length 740
Comment CRISPR-associated helicase, Cas3 family [Pseudanabaena sp. PCC 7367]
Sequence
MQKLQYVAHTPNKLGEWHSLQEHLSDVAIKAQGYAAKIGCDELGYYAGLWHDLGKYHPKF
QQYLECCHLATENGRSSSCKKFPHAIYGACLAREYLQPLAPIIWGHHAGLPDKDKLTNDL
SKENHAVQNEYRAVLQHVPETLLQVRSIQKSKQAMQGLAKDSTEMLIRMLFSCLVDADYL
DTEEHFDPDAPKLRGGYKTVNLLWKIFQADQQQLFDRVKGIDSKVNQIRSEVYLACVEAA
AQMPGVFRLAVPTGGGKTRSGLAFALKHAMIHNLDRVIVAVPYTSIIEQTVNVYRNILGE
ADVLEHHSAAKEPDDEDARQSYAKARLATQNWDASLVVTTTVQLFESLFANRPSRCRKLH
NLVGSVIVLDEVQTLPMFLLTPILSGLKELVDRYRVTVVLCTATQPALEGESRYLEGFTA
GSVRDIVSSALAKQHFAGLARVNYEIKEQTWSWEQLVADIKEHNHDRALIILNTRKDALA
VLDTLQNDDEIDADSLLHLSTLLCGEHRRQVLNQVRNRLDRHQPCLLVSTQVVEAGVDLD
FPAVYRAIGPLDRIVQAAGRCNREGKMPEKGRVVVFEPEQGSKPKGDYETAAKRAEGILK
SPELDLHNPDTFETYFKVLYKDVKLDQLDIQKKRTNFNYPEVAKNFKFIKDDTTPVVIQF
DDRVRKHLKQIQRRDLNSGDYRKLQPYLVNLRQNDFKGTEALREEIAPGLWVWERLSYDE
LKGIKIGDRSIDFDPADLVQ
Download sequence
Identical sequences K9SHD6
WP_015164988.1.5078 gi|428217985|ref|YP_007102450.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]