SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428218048|ref|YP_007102513.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428218048|ref|YP_007102513.1|
Domain Number 1 Region: 95-229
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.85e-33
Family NlpC/P60 0.000013
Further Details:      
 
Domain Number 2 Region: 6-69
Classification Level Classification E-value
Superfamily Prokaryotic SH3-related domain 0.0000000375
Family Spr N-terminal domain-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428218048|ref|YP_007102513.1|
Sequence length 238
Comment NLP/P60 protein [Pseudanabaena sp. PCC 7367]
Sequence
MLNYDRLYHSNQNINLYSSPDLQELVTQVAGGLCLQVLSDLPDPLADIQKPIQVQLLADA
YVGYLNPIDRHKLIAIASEDLDAYRPLALTRSEIESRIDQAIAFAKVAMACPNEYLWGGT
VAPNYDCSGLVQAAFGSVGVQLPRDSYQQEAFLEPIEIAKLEPGDLIFFGSTTKTNHVAI
YLGAGQYIHSSGKDSGRNGIAIDCLAGGDPIASKYAAQIRGAGRINHCYQGVWQAAAF
Download sequence
Identical sequences K9SIW7
WP_015165051.1.5078 gi|428218048|ref|YP_007102513.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]