SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428218065|ref|YP_007102530.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428218065|ref|YP_007102530.1|
Domain Number 1 Region: 118-177,230-251
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.000000000000186
Family 7-Fe ferredoxin 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428218065|ref|YP_007102530.1|
Sequence length 431
Comment 4Fe-4S ferredoxin [Pseudanabaena sp. PCC 7367]
Sequence
MSLSNPFRGINATTDAPLASLRSRQWVKLICGASYQDLPKIRNLALVYALAGVDCIDMAA
DPAVITAVREGVAVARLLYQKAFAPNASTDTEINAELDLDLDLEPLDISDLNINNQINNQ
AAPNPWLMVSLNAGEDPHFRKAEFNYLECLTHCDRPCVDVCPTQAIQFNQVEVHNDRAGL
SERNNQIREQGKSGNSGNSGNSEDLSFTSSASHLSNLATKPQGEVLDNLCYGCGRCLAVC
PLSIINTREHTYTPEILLNEPIDAIEIHIQPWRVEEFKRLWQRLLPVIPKLKLLAISFPD
CDNLKDYLLALLEWMKPLPQQLVWQADGRPMSGDIGNGTTQAAIKLGQKVLGFELPIGFV
QIAGGTNASTARKIDEAQVKVAGVAYGSYARKLIMDLLEQGGDRLEANPQLLKQAILKAK
NLVGQTKHKAS
Download sequence
Identical sequences K9SHL6
WP_015165068.1.5078 gi|428218065|ref|YP_007102530.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]