SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428218183|ref|YP_007102648.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428218183|ref|YP_007102648.1|
Domain Number 1 Region: 792-941
Classification Level Classification E-value
Superfamily beta-Roll 1.83e-17
Family Serralysin-like metalloprotease, C-terminal domain 0.0013
Further Details:      
 
Domain Number 2 Region: 179-554,590-651
Classification Level Classification E-value
Superfamily Pectin lyase-like 8.07e-17
Family Galacturonase 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428218183|ref|YP_007102648.1|
Sequence length 975
Comment hypothetical protein Pse7367_1945 [Pseudanabaena sp. PCC 7367]
Sequence
MNDNTGNLDSLKSGAFGGGENGSEAVNLVFVDSDIPDFESVIAGLDPSAQVVVLDPELDG
VQQITQELSWHDEVASIQVISHGSDGSLQLGATQLDASNIDAYSADLQSWGDHLSEDADI
MLFGCDVAGSPDGYTFVEQIATLTGADVAASIDPTGSAALGGDWDLEVTTGAIEASAALS
AAAQADFGGLLATFNVAAGDTAGLIDAINMANDEIANPGEDTINLAASSTYTLTTPTAES
QTAIISTAFNQPVGATGLPFITSEIIINANGSTLTRDGAAAPFRFFYIPRGDNLGGNTVD
SPRFSATDSRLVLNDITITNGQTEAPGMLDGIRTDGGVLYNIGGTVIINNSFLDGNFAAG
VGGAIQNADFQDPVTNRFEGTMVIANSTISNNTAFGDGPGVVFPVDGGGGINTGAGGDNG
NPGLTIINSTVSSNTAGGDPATNARGGGILQSGPGELVIVNSTVAFNTVIAGASGIGGGI
YRSTLADNGGFFNSGDIFAGNNVIAGNVAPASPDVFGDFLDTAPPGANLVGDDTGSTFAS
GPLTFATEGVGGVDEILDPTLALNGAPAGSPLTHAMRQPGDGLVPAVADNPLFDVGTNDT
YNQTVTNLETFYTSIGLDAAVVADLIGTIDTTDERGAPRITNAIIDLGAVEQLSDVDLAV
DKAPAPGSTLEVLPGAEITYTIEVTNNGGADASNVSIEDTFPVELLGVSWTIVDTEGTLF
EGTGDIDQTGVVVEAGETATVTVTGIVNCDLGLSVSLSNTATATPIGQMDANPLDNTDTD
TSFFTPLANSPGVFGGPNDPFIAGTPNGDLIIGGDPNQGINGNFGDDTIFGGKGIDRING
GLGNDSLIGGDGNDVLLGGEGNDTLDGACTSQGVGQIDRLTGSGFSGDDVFVLGNQLGVY
YLGNGNDDFAYITDFNPDGDQLVLVGAPADYTTQTISLMVEGRNIMGQGIFFGGDLIALL
QQSAADLNSDDVVYI
Download sequence
Identical sequences K9SJA1
gi|428218183|ref|YP_007102648.1| WP_015165184.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]