SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428218256|ref|YP_007102721.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428218256|ref|YP_007102721.1|
Domain Number 1 Region: 1-157
Classification Level Classification E-value
Superfamily IpsF-like 5.89e-62
Family IpsF-like 0.00000598
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428218256|ref|YP_007102721.1|
Sequence length 159
Comment 2-C-methyl-D-erythritol 2,4-cyclo diphosphate synthase [Pseudanabaena sp. PCC 7367]
Sequence
MNIRIGNGYDIHQLVSDRPLILGGVTIESALGLLGHSDADVLTHAIMDAMLGALALGDIG
HYFPPSDPKWAGADSIELLKEVNQIITAQGWQIGNIDAMVVAEAPKLKPHIKLMRDRLAA
ALSIDVSQVSVKATTNEKLDAIGHKQAIATHAVVLLAPV
Download sequence
Identical sequences K9SJD5
gi|428218256|ref|YP_007102721.1| WP_015165254.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]