SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428218297|ref|YP_007102762.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428218297|ref|YP_007102762.1|
Domain Number 1 Region: 1180-1346
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.6e-23
Family Clostridium neurotoxins, the second last domain 0.095
Further Details:      
 
Domain Number 2 Region: 1357-1398,1433-1621
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000247
Family Leech intramolecular trans-sialidase, N-terminal domain 0.052
Further Details:      
 
Domain Number 3 Region: 290-502
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000251
Family Leech intramolecular trans-sialidase, N-terminal domain 0.053
Further Details:      
 
Domain Number 4 Region: 1662-1737
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000137
Family Pentraxin (pentaxin) 0.052
Further Details:      
 
Weak hits

Sequence:  gi|428218297|ref|YP_007102762.1|
Domain Number - Region: 687-750
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 0.00116
Family Crystallins/Ca-binding development proteins 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428218297|ref|YP_007102762.1|
Sequence length 2454
Comment hypothetical protein Pse7367_2066 [Pseudanabaena sp. PCC 7367]
Sequence
MQPQWANYIRTYSDRNYQHTALVSHTGVLIAFAIGDDRRIYYNVLDQQNNPESIDVNNWL
DTPQELIFPREIAQVGFAIVANKGLPMVRSDGEPATSPADADWFHSSTARLTEIAPFQVF
SDNQYVYLFRQAIAAGDPNMITVNDVDGEPQPIVDRTLLVDRFILAGTMLKTVREVRYRR
SRHKVLPAGPRDSVGAVDMNNMPFYEPTQELDFVRNIGLGRFSVIQVPSGIPDVNRWQIF
VHNHLTERIDSYNIERSADGLFNTQGSESPAAFERMGHAETALRLESGAYVTGQAQVINR
PSFNISVWIKPESTGTIYAEGIPAASTDILQLNIIDTNLDIDGQSLAGYGLEVVSYHQAT
NNTATVRSAANVIEMGEWNFISLSFLPMLGSQTPPENSGVVVMMVGNVVVNDGEAESSYL
LFPTHDGANLVATLGINAAAIQGGTQSATPITATIDELSIWDRARSETELQQKQSIRLVG
NEFGLLTYWQFDEGSGDTIYDQTDTLNSGTLNATSGGTWLQSDAPVGDNPNLRRTSFGFG
DRNVAGKGIAAMLYYQQEMFSPGDNRPAEPTKQSARVMLAATTTVTGEDNEPKIAVLDFG
VDRRGRLSQVPDRINLPLIETGDNDPNALIAEAIQLEQTDIPTTQAQIEFLQQEIARNES
LLATYAAQITESQAQLVQLQNQQIGSGVTLYQNRHYIGLSARLSLNYADNLPSIVNGDND
SIQVDSGITAHLYTGANFTGSVITHNESRTVLGGTYFSLNARSARIVVNPARQQQIDFHT
NRITSNNALIDEINNVILPDLQAQLAAAIDLLASQQARLADIRNFLQGQLSLPMGLIHID
PNGFNVVGGLLDFAITDDAPELFESGSGMLRIYYRGLDDRFQAITYNTNVSRASVILSGV
VQMQERAPGLGRSEAKVTLADDPNPDGTLVTITDDSNPSICQVTLTNRILNITETWQRVP
RDPAGFAQVISGAAREIVYLGRLAADLQGNVNSLTLTDPAPTSYQIGASIVIGSGQANLR
TAIAVGDTTIEIEPIDLVDTIRAGTTVSILVYTYDRYSAFANTGSMMQSPYDLKYGSMLV
ELLYTETGNIENVSNMPLTGESRPNAWITDSPGNALEILSGHLEGDPSRMIIEGDRSIET
WIYPERIVAGDIAYLVSQHTPEPINEADPPASSYGMAIEGKPFLSALQLNGTNTRVDLAG
INLANRSFTIEIYVKRNAVGGQLDFIFSQGSTPTAANQSLHIGFLANNILRYSFWGVPSD
MDTTQAQTDTNWHHWTFTYDVNTNDRKIYRDGIEQEAIRAVAPAPYNHSGTDLHLGYYYQ
GNDYGRISVDEVRIWDHVRDEFEINRTIAQRLKGDEAGLMAYYHFDNSDASNRLIDLAND
PTLDGEIIGSPTLVDSPIAGYVLLAAVREKYLTTVNPMNINRWKHLAAIYNEAYALRFDG
NNDYLDCGGLANLASEGDFTIEFIYLHRPNERYVPILQKGRVGRNTPELTCWICLRRTNA
TFVIYFGYEDSDGNLHVASSNSLGIAAFSNQRITITGKQEEDNYTVRMYRHGSSIGVNNN
QASGGAPVTNGQTLEVGRVYGTPSGSSISGDELRYLESTLSSLRFWNRARTDAEIRDNSN
LGEELIANWGFEEGTGNITTDTVRQQDARIVGAIWVPDIVPENTRLELYVNGMPIVTQTR
EAIALPENQFNLGRDFRGEIDEVRIWQEVRSQEQLLDNLFSHLKGERRQLLAYYEFESDP
VSQGNVTTVNDGSLRGNQLTTTTDAEIRHVFSSAPISDDAILVRNALGSVPNEFQETVDR
RPAIAEYADLQTSQTGVVSGIHKRCYSFVQNSEWHLFTGYKVGSLITEWISQVQFDPQII
GYIEGAPPTPSENLTAGIINDAVRDYVNTTSLEFVESDNVSYTISTSKNSGFNSSFEASL
SASIGLKKQAVTAPLGVGVATDVVSSGISGSVGTKLDTNLNWSSSEQQGSGINVSRNASV
SLGGNWGTTDIDLRLNKELPRRYLTANVGFAIVESETADLFAIRMAHNRALVAFRILPNP
DIPKDTNIISFPINSRYTKQGTLDGAVGYDQNGKVLDPDYPEAANYGEYSYFKPREAYAL
RRQIQNEEVQLRTFYQDFSTTPPGSTGILSGGLTGAALGLAASGGGVAAPFVAAAGIAAG
GLIDALASDNDLPDRYANRNIVNTYVWTADGGLYSESTQTADSQQESHSGSYNFQGNLNF
GFSTSGGLIAGVDFDTKATFGGSLNLTKGRTEDASQSFSINVVNNTPGDLQRFTLQPDGA
LARDRNNLPIREYDVNGVPINHPGKVDAYRFFTFYLTPDTNNYDTFFNTVVDPIWLEQNN
SANAQALRQAQQTESGPACWRIFHRVTFISRILPEFPDPTAPPLDRAVQGTDMSSSYELI
RLVEPFVQNATGSTAEFDAAIRNALRRYLPELSSSLTQEVVIALAEYFGVEGLI
Download sequence
Identical sequences K9SKM6
gi|428218297|ref|YP_007102762.1| WP_015165294.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]