SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428218613|ref|YP_007103078.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428218613|ref|YP_007103078.1|
Domain Number 1 Region: 3-59
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.44e-19
Family Chaperone J-domain 0.0007
Further Details:      
 
Domain Number 2 Region: 196-278
Classification Level Classification E-value
Superfamily TPR-like 0.000000569
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 
Weak hits

Sequence:  gi|428218613|ref|YP_007103078.1|
Domain Number - Region: 119-131,223-230
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.022
Family Formin homology 2 domain (FH2 domain) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428218613|ref|YP_007103078.1|
Sequence length 283
Comment heat shock protein DnaJ domain-containing protein [Pseudanabaena sp. PCC 7367]
Sequence
MHQFECYRVLGLPRNASLDDVKTAYRRLARKYHPDINRDDPTAADKFRLVQEAYQLLKNT
GNEPTIRPHRSPQAGVKVRTAHHSDRSDRTANPDRHNHTQRSHARNAQPNQKTNAGHRPP
PPPPKTAPPKPSQETKQTTKERRAQWFANAAKRKYRKSSANGGKNKKRTTPGSSNGSNID
PEVKLKSDTLRRLQDLLKQKKYVVAIAVAEGMREKFSTSPEVIHWQAVSYHRWGSDLLMQ
GDFKKAELYLNKALTTDPRNRELCFEVKRDLERIGRHQSQDDN
Download sequence
Identical sequences K9SKJ5
WP_015165606.1.5078 gi|428218613|ref|YP_007103078.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]