SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428218799|ref|YP_007103264.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428218799|ref|YP_007103264.1|
Domain Number 1 Region: 562-741
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.0000000000014
Family HD domain 0.035
Further Details:      
 
Weak hits

Sequence:  gi|428218799|ref|YP_007103264.1|
Domain Number - Region: 139-201
Classification Level Classification E-value
Superfamily t-snare proteins 0.00322
Family t-snare proteins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428218799|ref|YP_007103264.1|
Sequence length 813
Comment 7TM receptor with intracellular metal dependent phosphohydrolase [Pseudanabaena sp. PCC 7367]
Sequence
MSMGTIPKPLQRLFFCPPKKWIGRAIVGLTFVSLSATLSVRFLWEPQLKVGTFVTRDIRA
PRTAETVDREATREAKERARQEVPQIYRVDNTARVRSVQHLEELLIVGDQIRDAVGPSPY
IDTSLLSYGVQLYLRECPEPVWQDLQKRVETLQQQLEQLQTADSSIANQNNIYGRVVTEL
LRRRNLMSEAEYRDLINQIEQARGRYKTAVIALEAGPDLFQDYLLDLRDSEWDVDKQAAL
LALNNLMAEGLIPGLPPELRQYRISSRPNLPIAEYRRQIIIDLLDTVLIPNLEPDYVATD
QLAAKAAEEVEAKVITLQAGEVIVRAGQQITEKEFAFLDSLGLAQRRPNFLGIVMVSGAV
ALAMSIFGLVNWRLGHLLGVRLKLMDVAAIGIVCTSVSVAAVLLSPAVITFIPFATVGLM
LGSFYGSRLAALTTILLAVPLVVGLAPTAIAFSPILVGAILAALLTNRPHTRSHLATAGI
LVAIVQAAAYAFAALLFAPNLPLVAVATLALQYAAGGLVCSIVALGAIPYLEQVSYALTP
IRLAELANLDRPLLRRLVTEAPGTFQHTLFVANLAEAGARAIGADTSLVRTGTLYHDVGK
TLHPEFFIENQMGQPNPHDKIDDPWRSAQIIREHVTGGIKLAQKFRLPEQLIAFIPEHQG
TITIAYFYHKAKAIDDTVTENDFRYEGPIPQSRETGVVMLADACEAALRSLGSDTTIDEA
YAMVRRIFNARLADHQLRDANLSPEDLENIIPVFIKVWQERNHGRIKYPALAKKFDPTGS
ELPEKKKPPEPSEQSQQSEQLNQPSPEPSQPNS
Download sequence
Identical sequences K9SLL7
gi|428218799|ref|YP_007103264.1| WP_015165792.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]