SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428218883|ref|YP_007103348.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428218883|ref|YP_007103348.1|
Domain Number - Region: 179-199
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0307
Family Di-heme elbow motif 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428218883|ref|YP_007103348.1|
Sequence length 223
Comment hypothetical protein Pse7367_2665 [Pseudanabaena sp. PCC 7367]
Sequence
MNRNRRNRPKNWTNWLRTKTFGLVALISVALITISACSSGPAPTATAEVGISPELVTDYI
HTVLEADRTAYTKHVISRLTKLEGKEKPDGVVDAEATEAWKETGGVPLPAQMFRLGSEIA
LEADTFTYGLISSWNINDNQAPRNEFEKTAMKQVEETSEPYKDFQEIAGQRYYSALYPDV
AVAEACVTCHNEHPVHKERYPDKVFVLGDVMGGVMINLPLGSS
Download sequence
Identical sequences K9SLB2
gi|428218883|ref|YP_007103348.1| WP_015165876.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]