SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428218935|ref|YP_007103400.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428218935|ref|YP_007103400.1|
Domain Number 1 Region: 18-245
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.42e-66
Family Decarboxylase 0.00000474
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428218935|ref|YP_007103400.1|
Sequence length 249
Comment orotidine-5'-phosphate decarboxylase [Pseudanabaena sp. PCC 7367]
Sequence
MSNQPATQPEKSEPTNLQERIIVAIDVPTIDAALALCDRLPQVGFWKVGLELFVSTGAEI
LTELKQRQKKIFLDLKLHDIPNTVAAATRAAVKYEVDFLTVHAVGGRNMLKAAQAEVVDS
NTRLLAITLLTSLSSRELAFDLKIPLELPEYALQMALMAQDCGLYGAVCSPLEVSGLRSL
LPPNPTGAEFGLVTPGIRPAGSEQGDQRRTMTPAQAIAAGASYLVIGRPITQAEDPAAAW
QEICAQLSN
Download sequence
Identical sequences K9SK36
WP_015165928.1.5078 gi|428218935|ref|YP_007103400.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]