SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428219196|ref|YP_007103661.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428219196|ref|YP_007103661.1|
Domain Number 1 Region: 1-213
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 0.000000000000361
Family ROO N-terminal domain-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428219196|ref|YP_007103661.1|
Sequence length 265
Comment hypothetical protein Pse7367_2982 [Pseudanabaena sp. PCC 7367]
Sequence
MHLTWLDNNGWLIELGGQRILLDPWLVEPLVFGGMDWLFKQERRSPMPIPENIDLLLLSQ
GLEDHAHPPTLKQLDRQIPVVASPNAAKVVTELGFGNVTVLNHGESFNLTESVTIKAIEG
DPIGPFVLENAYILREGTASDNQDGEDRISSIYYDPHGYHYESLKAEKPIDVVITPLMGI
SIPLLGPVVKGADSAIDAVDLLRPKLIIPTASGSDAKMTGVLTRVLKADGGAEKLKNLAA
ARNLTVQVIEPKPGDRFSPALAVPV
Download sequence
Identical sequences K9SLY5
WP_015166189.1.5078 gi|428219196|ref|YP_007103661.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]