SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428219215|ref|YP_007103680.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428219215|ref|YP_007103680.1|
Domain Number 1 Region: 1-312
Classification Level Classification E-value
Superfamily NAD(P)-linked oxidoreductase 5.76e-58
Family Aldo-keto reductases (NADP) 0.00058
Further Details:      
 
Weak hits

Sequence:  gi|428219215|ref|YP_007103680.1|
Domain Number - Region: 280-357
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.000373
Family 7-Fe ferredoxin 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428219215|ref|YP_007103680.1|
Sequence length 375
Comment NADP-dependent oxidoreductase domain-containing protein [Pseudanabaena sp. PCC 7367]
Sequence
MRYRRFGKTEMLMSVFSFGAMRFLESEENAIATIKAAIDYGINHLETAKGYGKSEEYIGA
AFKAGLHKLRDRLLITTKITPTWDAQTMRDLIQRSLQRLNISYIDNFDIHGINTWEHIEM
VQKPDGCMQAVREAIDQGIIRHVGFSTHGPLAVILAAIETDLFESINLHYYYFNQHNEPA
VQLADQKDMGVFIISPSDKGGMLYTPPEKLKQLCAPYTPIEFNDRFLLADPRVHTLSLGA
ANPDQFTSHALAWDNDQPMDAQELEILQRMNQNYLSLGSDRCAQCFECLPCPEVINIPEV
LRLRNMAVAFGMEEFGKYRYKMFENAGHWFPGTKANKCTECGDCLPRCPEKLDIPKLLFD
THDRLYTKEGKRLWG
Download sequence
Identical sequences K9SKW4
gi|428219215|ref|YP_007103680.1| WP_015166208.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]