SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428219388|ref|YP_007103853.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428219388|ref|YP_007103853.1|
Domain Number 1 Region: 5-192,244-382
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.66e-71
Family TK-like PP module 0.0039
Further Details:      
 
Domain Number 2 Region: 317-508
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.83e-61
Family TK-like Pyr module 0.01
Further Details:      
 
Domain Number 3 Region: 494-626
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.44e-36
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428219388|ref|YP_007103853.1|
Sequence length 639
Comment 1-deoxy-D-xylulose-5-phosphate synthase [Pseudanabaena sp. PCC 7367]
Sequence
MRLRDIVHPNQLHGLTVAELESIAQEIREKHLQTIAATGGHLGPGLGVVELTLGLYQTLD
LDRDKVIWDVGHQAYPHKMITGRYEQFHTLRQKDGVAGYLKRTESPFDHFGAGHASTSIS
AGLGMAMARDAMGDDYKVAAIIGDGALTGGMALEAINHAGHLPKTNLLVILNDNEMSISP
NVGAIPRYLNRLRLSEPIQSISENLEDQIRNLPFLGGSISPEIERLRDNFKIVTMLQNKV
GAIIEELGFKYIGPIDGHNVKELIDTFTMAHTLKGPVMVHVSTTKGKGYKYAEVDKVAYH
AQNAFDIATGKATPSKPKPPKYSKVFVDTLIKLAEHDKRIIGITAAMATGTGLDKLQTKF
PDQYVDVGIAEQHAITLAAGMACEGVRPIAAIYSTFLQRAYDQIIHDVCIQKLPVFFCLD
RAGIVGADGPTHQGMYDIAYLRCIPNMVMMAPKDEAELQQMLVTGINYTDGPIAMRYPRG
NGIGVPLQEEGWQPLPIGKGEVLREGDDVLLVAYGTMVNTAMQAAELLVEHGMEATVVNA
RFAKPIDLELIAPLAQKIGHVFTLEEGCIMGGFGSGVLEGLMDMGIMLPITRLGVPDILV
DHASPDEAKAGLGLTSGQIKDRILTQLTTSETRSPINTN
Download sequence
Identical sequences K9SMR8
gi|428219388|ref|YP_007103853.1| WP_015166381.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]