SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428219534|ref|YP_007103999.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428219534|ref|YP_007103999.1|
Domain Number 1 Region: 630-683,712-909
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000000234
Family Galacturonase 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428219534|ref|YP_007103999.1|
Sequence length 942
Comment spore coat protein CotH [Pseudanabaena sp. PCC 7367]
Sequence
MLIHKGDRDLEPSSGLQGSQAEQNAGLTKNANPGESANPVINGSSLTSSGSPRSKRGRFR
SRLTTLGLTTLIIAGSFGAGYMFHKHEAHKFLLANLGNFNPSSIGRYLEALLRAPDLPTV
QVDMKFKHYKDLARTRETALQRGRILAEDKYFVSAKLRYDGQVIPVKMRFKGNGIDHLDS
EKWSFRVHVKDDKHFLGMRRFSLHSPKTRNYLYEWVWLENLRREGVLAPRYQFIDLNFNG
SPKGVYAIEEHFSVELYESQQRREGIVITGNDAFEVSRAKRVDRDPELSQQRDQAIAMLK
AFQEGQLAASEVFDVELMAKFLAIVELWRAYHTLTDWNTHFYYNPITAKLEPIGRDGYHY
DNVYNWGMQGMDIFSDDIRGSGSRWRNQNWTSQVLQDPIISEAYVRELERISQPEYLEQV
RSPLQKQFKELQLVLYKDPDIDPQKNTLLEQVWQTAIDRQEAIRQSLSETNALSAFVKVV
KLGEANQDRRSYLQIEVNNRLVQPVEVLGFKLNEDQNFYPAIETWQDTAAGYTYYRPGDA
TVVLRPAEHSQVGRSPLNADLQEKTVFLIPLPPGFQQNQLGELPEIRIAYRFLGLERAIE
TTVYEYPQTAMPSLTAALAQHPFLEQGDRPDTLIVKPGQWDVVGDLVMPRGMNLQINPGT
TLRFEPEAVLLADAGMQLLGTEQAPIRLMAQAEQWAGVATIALGSNASSNDKRNSQEASQ
SNWQHVIVEQTNGISRAGGLLESSITFHNSVVKIQNLQLVDSSADNALRFSNSEFEVSAS
QFINLAGDGIDAEFSSGAVSNSEFTNIQADAIDAEGTDLAVINSQFSQIEDKAISAGQGS
KVSLQDLEIKDVGIGIASLDRAAVQIVNVAIENAKQAGLIAYQARSEWGSANMTARQVRF
ADTRTKTLIEAGSWIELDGDRLDGIGSEEFWAQIDQAELEVD
Download sequence
Identical sequences K9SNK5
gi|428219534|ref|YP_007103999.1| WP_015166525.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]