SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428219571|ref|YP_007104036.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428219571|ref|YP_007104036.1|
Domain Number 1 Region: 300-492
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.06e-46
Family Ribonuclease PH domain 1-like 0.0000102
Further Details:      
 
Domain Number 2 Region: 4-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-42
Family Ribonuclease PH domain 1-like 0.0000202
Further Details:      
 
Domain Number 3 Region: 143-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.36e-30
Family Ribonuclease PH domain 2-like 0.0016
Further Details:      
 
Domain Number 4 Region: 455-553
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.24e-26
Family Ribonuclease PH domain 2-like 0.00018
Further Details:      
 
Domain Number 5 Region: 559-645
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.39e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 6 Region: 624-700
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.37e-16
Family Cold shock DNA-binding domain-like 0.00077
Further Details:      
 
Domain Number 7 Region: 236-327
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.000000000000366
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428219571|ref|YP_007104036.1|
Sequence length 714
Comment polyribonucleotide nucleotidyltransferase [Pseudanabaena sp. PCC 7367]
Sequence
MTPTEKTIPFYGREINLKMGLIAPQAGGSVLVSCGETAVLVTATRGSARDGIDFLPLLVD
YEERLYAVGRIPGGFLRREGRPPEKAVLTCRLIDRPMRPLFPNWLRDDIQIVATTMALDE
QAPPDVLGVTGASLAAQIAGLPFNGPMAGVRVGLVGDEFIINPTYAEVENGDLDLVVAGT
PEGIVMVEAGANQLPEQDMIEAIEFGYEAVTELINVQNEVLKDLGIEKVEIVPPEVDPTL
ADFIQDRASEKVTKIISSFEKVKPVRDDALDAVKAELEAEIAELPEDDSIRLAATGKALG
NAYKSLTKKLMRKQIIEESVRIDGRKLDEVRPVDTMVSLLPRVHGSALFNRGLTQVLSIA
TLGTPSDAQDLDDLHPDESKRYLHHYNFPPYSVGEARPMRSPGRREIGHGALAERAILPI
LPGGEFPYVLRVVSEVTSSNGSTSMGSVCASTLALMDAGVPIAKPVSGVAMGLIKEGEEV
RVLTDIQGIEDFLGDMDFKVAGTDAGITALQMDMKITGIAIDTIKDAIIQAKAGRLHILE
KMLAVLPEPRPEISPNAPRILTMQINPDQIGLVIGPGGKTIKGIVEETGAKVDINDDGTV
TIASVESAGAKQAMRIIEGMTKQVSPGDVFMGKVTRIIPIGAFVEFLPGKEGMVHISQLA
EGRVGKVEDEVNVGDEVIIKIREIDQRGRYNLTRLGIHPEQAAAARGGDKEEES
Download sequence
Identical sequences K9SN16
WP_015166562.1.5078 gi|428219571|ref|YP_007104036.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]