SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428219683|ref|YP_007104148.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428219683|ref|YP_007104148.1|
Domain Number - Region: 12-86
Classification Level Classification E-value
Superfamily Acid phosphatase/Vanadium-dependent haloperoxidase 0.00418
Family Type 2 phosphatidic acid phosphatase, PAP2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428219683|ref|YP_007104148.1|
Sequence length 148
Comment acid phosphatase/vanadium-dependent haloperoxidase-like protein [Pseudanabaena sp. PCC 7367]
Sequence
MHPFGEILDNQLLLIAVLASFLAQFLKLIIVFIRVRKIELRVLFETGGMPSSHSALVAAL
AAGIGRSQGWDTPAFAIASVMAFIVMYDAAGIRFAAGKQAKVINQIIFEMFEDDHVLTGD
PLKELLGHTPAQVLMGAILGVSLMWLLQ
Download sequence
Identical sequences K9SNJ2
gi|428219683|ref|YP_007104148.1| WP_015166674.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]