SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428219731|ref|YP_007104196.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428219731|ref|YP_007104196.1|
Domain Number 1 Region: 36-211
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.98e-72
Family HD domain 0.00000205
Further Details:      
 
Domain Number 2 Region: 215-389
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.94e-60
Family RelA/SpoT domain 0.0000102
Further Details:      
 
Domain Number 3 Region: 399-470
Classification Level Classification E-value
Superfamily TGS-like 4.74e-22
Family G domain-linked domain 0.02
Further Details:      
 
Domain Number 4 Region: 663-741
Classification Level Classification E-value
Superfamily ACT-like 0.00000000000512
Family AF1403 N-terminal domain-like 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428219731|ref|YP_007104196.1|
Sequence length 746
Comment (p)ppGpp synthetase I SpoT/RelA [Pseudanabaena sp. PCC 7367]
Sequence
MTLAIDSHPNTDLGSLMPEWLKGCWQKIAAAEPIDPEDPEAIICRALKFACELHEGQYRA
SGEPYILHPIEVATILRDLGGGSKAMIVAGFLHDVVEDTEVTVADIEAEFGAEIAALVEG
VTKLSKFNFESKTERAAENFRRMFLAMAQDIRVIVVKLADRLHNMRTLEHLPAPKQANIA
RETMEIFAPLANRLGIGQIKWELEDLSFKYIDKDAYQQMRSLVVENRRNREERLARVRDI
LRSRIEQLGLTNFEISGRPKHLYGIYQKMQVRQKKYEEIYDVSAIRIIVENKEACYRVLA
VVHDCFRPIPGRFKDYIGLPKPNRYQSLHTVVIGPNGRPLEVQIRTWEMHHIAEYGIAAH
WKYKETNSSHQATSQEDEKFTWLRQLVEWQRELKDDQEYIDTLKENLFDHEVYVFSPKGD
VYCLPRGATAVDFAYRIHTELGNHCAGALVNEFMVPLDRKLQNGDIVTVLRHKNAHPSLD
WINFVATSSARHRIRQWYKRSRREENYGRGRSMLEREMGKGGLDSLLKSERMLEVARRCN
YHSVDDMLAALGYGEISLNMVVNKLREEQTTQEAAIAIPRLPSAPSANAASPTKSPILGL
EGLPYRIAGCCQPLPGEPIIGVVPRGGNRSIAVHKQECENIADFPGDRLIPISWNNRDDV
DRPSIYTVDIRVETIDRVGVLKDILARLADEKVNVRHATVDTRPGDTATIELSIDINSRN
QYEKLHYKISNMSDIVAVRRINRNDS
Download sequence
Identical sequences K9SNK6
WP_015166722.1.5078 gi|428219731|ref|YP_007104196.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]