SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428219806|ref|YP_007104271.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428219806|ref|YP_007104271.1|
Domain Number 1 Region: 4-327
Classification Level Classification E-value
Superfamily Pectin lyase-like 8.57e-24
Family Pectate lyase-like 0.051
Further Details:      
 
Domain Number 2 Region: 287-602
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.73e-21
Family Virulence factor P.69 pertactin 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428219806|ref|YP_007104271.1|
Sequence length 784
Comment polymorphic outer membrane protein [Pseudanabaena sp. PCC 7367]
Sequence
MAVINVTTTLDENDGGLGLGVGDSLREAIIEANTNADAVDTIVLESGLIYTLTLVGAGED
VAATGDLDILNADTITIETDGAAQATVDATGLGDDRIFDVLNAGATLNIDNLVLTGGNVT
AAGEDGGAIDLISGATLNVTDSTITGNTADNAGGGIAGYNDHTISIINSEITNNTATNSY
GGGMYFYDGGTATITGSTISGNTAADDGGGAHFHDDWNATITDSFINNNYTSDDGGGLHF
QDYGIVNITNTTISGNTADSDGGGLYFANDGNLTLTNSIVSNNDAANDNGGGIYGNNGND
ITITLSTVSGNTSGGDGGGVHTYAASGMNPNPSLTITESTISGNSAGGAGGGTFSLYNNT
VEITDTTISGNTADGEGGGGVYIFNNNQLTIENSTISSNVTNGNAAPFFGAPGGGGLFVF
DGDTVDITNSTISGNTAADFGGGAYFGISTVDINNTTIAENEANFGGGISTYTTSLTIGN
TIIATNTAITNSPDIFDSNGSPIVSSGFNLIGDNTSVEGIFPAGIPNANDDFVGTAMDPI
DPGLSPLADNGGPTETHALGDGCSVAINNGDPNFVAPPDFDQRGTGFDRVFGGRIDIGAF
ELQNSAGVLVFGNTSFGTPGSDTIVGDANNNTINGNGGDDSLFGSDGIDRVNGGLGNDFL
GGGLGNDFLNGGAGNDTMDGACGGTGTGEFDRLTGGGGAGADTFILGASFGAYYLGNGNA
DFAYISDFNSGADTIVLNGMLADYTFVPNTTVNNLTGQGIFNGGDLVAIVQQQMINTVTD
LVFV
Download sequence
Identical sequences K9SNR9
WP_015166796.1.5078 gi|428219806|ref|YP_007104271.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]