SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428219918|ref|YP_007083390.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428219918|ref|YP_007083390.1|
Domain Number 1 Region: 3-327
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.93e-90
Family C5 cytosine-specific DNA methylase, DCM 0.0000281
Further Details:      
 
Domain Number 2 Region: 366-408
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000103
Family Cgl2762-like 0.035
Further Details:      
 
Weak hits

Sequence:  gi|428219918|ref|YP_007083390.1|
Domain Number - Region: 266-274,324-360
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00307
Family Di-heme elbow motif 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428219918|ref|YP_007083390.1|
Sequence length 409
Comment DNA-cytosine methyltransferase [Pseudanabaena sp. PCC 7367]
Sequence
MYNCIDLFAGCGGMALGLKRSGFNHACLVELDRQAAQTLRANFDPATIVEADIIKLNREG
YFAQFREQIDLLSAGPPCQSFSYAGNQRGLDDRRGQLVYETLNTIEQVQPKMVLIENVKH
LSTINSGKVLKAILGRLHSLRYRTQWQILNANDYGVAQNRQRLIILATRKGWRIKLKYPT
KYAYKPVLRDALQDCPTSDGVQYSSEKARVLDLVPPGGCWQALPVELQKQYMGKSFDTEG
GKRGMARRLAWHEPSLTLLCSPAQKQTERCHPDHTRPLTVREYARIQGFPDSFVFTGSTY
SRYRQIGNAVPVDLAEAIGKSIIRVIAGIECKYCHSQHVLHNGRRRGKQNYHCQDCDRQF
IDSYSPKGYTEEVKQQCLHLYAKGMGFRAIERLTGVSHNSIINWVKKLG
Download sequence
Identical sequences K9SQ64
gi|428219918|ref|YP_007083390.1|NC_019690 gi|428219918|ref|YP_007083390.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]