SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428219968|ref|YP_007083440.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428219968|ref|YP_007083440.1|
Domain Number 1 Region: 1-57
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000325
Family G proteins 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428219968|ref|YP_007083440.1|
Sequence length 251
Comment hypothetical protein Pse7367_3780 [Pseudanabaena sp. PCC 7367]
Sequence
MPEQIIVTGEKGGVGKSFTARALVEYHLDRQLTCIAFDMDRSNPDLKRCYESVMPVRLAV
FSESSKLEDAANDTFNSATTCRTICNTPAQTFIPFKIWIEQNDILELAKEASVQLVIWFV
SDCGYDSLKLFQRSLHTFGAIIPHVFVKNYGMTEDWEPFEQDETLQQLLIDYQVQVISLP
KFVGNRDRNTIDELSLSFGEAREYEGFGAISRQRVKSFLRKCYQEFDRVLTPPVTDKPSR
KKRKSQAEATS
Download sequence
Identical sequences K9SQB5
gi|428219968|ref|YP_007083440.1|NC_019690 gi|428219968|ref|YP_007083440.1| WP_015146172.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]