SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428220006|ref|YP_007083478.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428220006|ref|YP_007083478.1|
Domain Number - Region: 179-243
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0603
Family Z-DNA binding domain 0.0076
Further Details:      
 
Domain Number - Region: 105-152
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0926
Family MarR-like transcriptional regulators 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428220006|ref|YP_007083478.1|
Sequence length 266
Comment hypothetical protein Pse7367_3819 [Pseudanabaena sp. PCC 7367]
Sequence
MKYQDLQFLLKLSTYQGKVSPGVSFRKEGITLAKKVFQSLGDDDLVDFDRKVEIAPAGKA
LLSFDASQLPISDQEIKVLARIERAPGALEPSKIRIKKINVAKRNEILQALGDRGLIKFQ
DKMCAISPKVWITTKGRQCLEQINEYFQSLRKSTSAALPEKSQAATATTQPTTQSSTPGD
SDVLEAIKQLDRKHNTDNFLPLFYLRDYLKDRLSREELDHALFRLQKKDAIELEPLAEPK
DYTSAQINAAIYDSFGTHPLFFAIVN
Download sequence
Identical sequences K9SN66
gi|428220006|ref|YP_007083478.1| WP_015146210.1.5078 gi|428220006|ref|YP_007083478.1|NC_019690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]