SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428220028|ref|YP_007083500.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428220028|ref|YP_007083500.1|
Domain Number 1 Region: 81-434
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.44e-43
Family Filamentous hemagglutinin FhaB, secretion domain 0.013
Further Details:      
 
Domain Number 2 Region: 463-566
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000188
Family P22 tailspike protein 0.087
Further Details:      
 
Domain Number 3 Region: 590-716,752-775
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000973
Family Filamentous hemagglutinin FhaB, secretion domain 0.036
Further Details:      
 
Domain Number 4 Region: 748-911
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000377
Family Filamentous hemagglutinin FhaB, secretion domain 0.084
Further Details:      
 
Weak hits

Sequence:  gi|428220028|ref|YP_007083500.1|
Domain Number - Region: 879-1022
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00286
Family iota-carrageenase 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428220028|ref|YP_007083500.1|
Sequence length 1182
Comment filamentous hemagglutinin family outer membrane protein [Pseudanabaena sp. PCC 7367]
Sequence
MADRQTNKIERQRLSSLSSAQFSKSQFKSRLRSLNCLSLALTTTGIGLGIYVGFSYLNYG
AALIGFESKYLDLDLDTVALAQEIQIVPDRSLPQNSIVQPDGNTLNITGGAINGANLFHS
FSEFSLNSGQTAHFQNDAAIANILTRVTGNNVSEIDGLIRANGNANLFLLNPNGILFGEN
ARLDLGGSFVATSADAIEFADGNLFAAQDAELVPLLTMTAPVGLQFNGNDGVNGAIEVQG
NGHNFTRESPIFAPVLGVGMLEDGLQVQPGQNLALIGNGINVNGGLLAAEGAHIELGSLS
AGRVLFTPIAQGWEFNYESSANRRDLKFSDINLRDRAAVDGSGSLTSGIYIQAHNLNITD
GSVVAIQNQGLMPGSDIRVNANGTVALSGTTTDTTIQSSITNTTLTPGASGAIAINAADL
HVLEGARLVSRTFSSGRSGDIELNVNNDFRIIGFSPINPLVFSTVSSTTLSDGRAGDIRV
NTQNLISRDAGVLSSATFDRGQGGDLTVVATDLISLAGAEPFTTTPSSIAATTFNSGNAG
NVTVTAKNLVIEQGGRIDSSTTATGNAGSVEINVSEAVILSGDPTQPGEPGLIASASAIV
SEGLQNAFNLPPVPTGNSGNVTVNTKLLQATNGGLVSVVSNGSGHPGTVRINSDHILLTN
RGGILALTDQESGGNIEITTGDIDMFAAFINASSIGTGDGGNIRINATGNVTVADVDFLN
VFNNVFVPFIFITPGSQNIAEVNGILTLTNSAGRSGDIDIQANQLTVRDGGLVVTGVFAS
STAGNLTINANQLLNVDGGLVVAISAIGDGQGGDASITSPVIKLSQAGLITSITLGSGNA
GNVIVQASEAIEITDTLLSGSPIPGFEVIPSSISSAATATSTGNGGSLVVITPQLTLSNQ
GVIAVNADNIGQAGNLLIQSDIISLDNSDITGNSISGQGGNVNLQVGDRLILRNASNIST
TAGLDLTSSGNGGNINISTPVLVALEQSNISANAFLGMGGNIDIVTAGLFTSTNSEISSS
SRLGVDGVVEVNSPDIDPSSGLVELETKVVDFSNLVAVGCDADRGNTFVVTGRGGLPATP
REIVRAEPSVIDWRSPFSTASSTTNNQSHLPDPSQSVSSVSSVSKATNPTPSTNPPSEIT
KINEVQGWRLDPNGQVILVADATNYESQSNRILPKRDCTTKQ
Download sequence
Identical sequences K9SQI3
gi|428220028|ref|YP_007083500.1| gi|428220028|ref|YP_007083500.1|NC_019690 WP_015146230.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]