SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428216901|ref|YP_007101366.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428216901|ref|YP_007101366.1|
Domain Number 1 Region: 8-311
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.78e-54
Family Protein kinases, catalytic subunit 0.00022
Further Details:      
 
Domain Number 2 Region: 385-530
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 5.79e-36
Family Pentapeptide repeats 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428216901|ref|YP_007101366.1|
Sequence length 540
Comment serine/threonine protein kinase with pentapeptide repeats [Pseudanabaena sp. PCC 7367]
Sequence
MAGDTICLSCGFPLRLRNRYVVNRPLGKGGFGATFLAADEGLPGYPPCVIKQLRPNSQSP
SILKMARELFEREAYTLGKIGNHPQIPRLLDYFEETSNFYLIQEYIEGETLKQEYERRGK
FNEIEIRKIIAEILPALGFIHQNGVIHRDVKPANIIRRKQDGQLVLIDFGAVSTQVNKIP
GNDNDGDDPSGLLTNFAIGTPGFAPPEQMAMRPVFSSDLYAAAMCCLYLLTGRSPKDFGH
DPYTGEINWRSQVQLSEHLNFIFDKMLQPSVAHRFRTAEEVLQAMESRAQPKPQILDDEP
NTYQTSQNRISRVDAANPNPTGGFPAARKSRVQASLSGRSLSGNDITSGLQLTRGGATRG
GIGRSGKELKGGRKVIVEYGQGKRNFANQDLAKASLASANLAGIVMSRSKLMETDFCQSD
LTGASFQGSIMSNAKLNGTNLTRAKMQRAILSKADLGSASLVNADLRESKLQFAYLSKAD
LTGANLSNADLTGAYLKQANLRRANLCGANLKGAKVSEEQLSYAKTNWSTIRPDGSKRLF
Download sequence
Identical sequences K9SFH0
gi|428216901|ref|YP_007101366.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]