SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428217724|ref|YP_007102189.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428217724|ref|YP_007102189.1|
Domain Number 1 Region: 17-318
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.86e-30
Family Galacturonase 0.055
Further Details:      
 
Domain Number 2 Region: 290-562
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.43e-21
Family Galacturonase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428217724|ref|YP_007102189.1|
Sequence length 744
Comment polymorphic outer membrane protein [Pseudanabaena sp. PCC 7367]
Sequence
MAIITVTTTLDVIAADGLTSLREAIIEANANADAADTIILESGLTYDLTLVGAGEDAAAT
GDLDIDSVVAGANITIETDGAAQATVDATALGDDRILDVLNADATLNIDNLILTGGNVTA
AGEDGGAIDLITGATLNVTDSEITGNTAADNGGGIAGDADNTITITNSLITGNEATGSDG
GGVYFDDNGNLTVTNSTVSNNTANTDGGGIHFDADGTATITNSLITGNEATGSDGGGVYF
DDNGTLTLTDSTVSNNTAGGDDGGGIHFDADGTATITGSTITGNTASDDGGGFYTDNRGN
LTLTDSTISNNTATGDQGGGIHLDNDSTATISTSTISGNSAGSDGGGSFFDNNSTIDITD
STFSGNEAGDESGALEADTPTLTISNSTFSGNTAATAGGAIQIDDGGTVDISHTTIAFNT
ATTNAGGIDLNDATITLNINNTIVATNEAPVGPDIDNTVGATITSGGFNIIGDNTDVAAD
FPAGIPNANDDFVGTAMDPIDPGLSPLADNGGPTQTHALGDGCSLAINNGDPNFVAPPDF
DQRGMGFDRVFGGRIDIGAFELQNSAGVLVFGNTSFGTPGPDTIVGDANNNTINGNGGDD
SLFGSDGIDRVNGGLGNDFLGGGLGNDFLNGGAGNDTMDGACGGTGTGEFDRLTGGGGAG
ADTFILGASFGSYYLGNGDADFAYISDFNSGVDTIVLNGVLADYTFVPNTTSNNVTGQGI
FNGGDLVAIVQQQAINTVTDLVFV
Download sequence
Identical sequences K9SIJ8
gi|428217724|ref|YP_007102189.1| WP_015164730.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]