SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ConsensusfromContig25711-snap_masked-ConsensusfromContig25711-abinit-gene-0.0-mRNA-1:cds:5847/3103-3 from Cyanophora paradoxa

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ConsensusfromContig25711-snap_masked-ConsensusfromContig25711-abinit-gene-0.0-mRNA-1:cds:5847/3103-3
Domain Number - Region: 27-113
Classification Level Classification E-value
Superfamily SIS domain 0.0222
Family Phosphoglucose isomerase, PGI 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ConsensusfromContig25711-snap_masked-ConsensusfromContig25711-abinit-gene-0.0-mRNA-1:cds:5847/3103-3
Sequence length 130
Sequence
MIFILSATAESPAQEFASTAPVVVMFAGFLPNLLLRMCEQAANADGLVIIGWSAFYPAAF
VAACRLIQGALQRVLMPPPADLRVRPLLSLNFEFLAIGFSGYRKRALVICAAAGAACTIG
VAFVQAEQLY
Download sequence
Identical sequences ConsensusfromContig25711-snap_masked-ConsensusfromContig25711-abinit-gene-0.0-mRNA-1:cds:5847/3103-3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]