SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|470176451|ref|YP_007562495.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470176451|ref|YP_007562495.1|
Domain Number 1 Region: 90-159
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000196
Family NfeD domain-like 0.0092
Further Details:      
 
Weak hits

Sequence:  gi|470176451|ref|YP_007562495.1|
Domain Number - Region: 27-86
Classification Level Classification E-value
Superfamily OMPA-like 0.0942
Family Outer membrane protein 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|470176451|ref|YP_007562495.1|
Sequence length 189
Comment hypothetical protein YM304_02430 [Ilumatobacter coccineus YM16-304]
Sequence
MIAILDLGLDLNVWPWVWLGVAVVFAIVELTVLAGTFVLLPFALSAFVAALAGWYDAPIE
AQWAIFILGGAALWALFWKYAKRFMAEHTNPEGVGADRLVGMTAIVTKPIDPDDVDRRGR
VKVAGEDWGALTEGRGLLAEGTKVQVTAMSGTRVIVTPLDIPLSPPPASGPPLNRPASPA
EQPARKEQT
Download sequence
Identical sequences M4ZVP4
gi|470176451|ref|YP_007562495.1| WP_015439805.1.75388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]