SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|470176640|ref|YP_007562684.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470176640|ref|YP_007562684.1|
Domain Number 1 Region: 35-139
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.66e-34
Family Thioltransferase 0.0023
Further Details:      
 
Domain Number 2 Region: 6-31
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0000658
Family Di-heme elbow motif 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|470176640|ref|YP_007562684.1|
Sequence length 140
Comment thioredoxin [Ilumatobacter coccineus YM16-304]
Sequence
MAGNIVSCPSCHAKNRVPSSSSGKPTCAKCHADLPWLVDATDGDFSAAIDTSRLVLVDLW
APWCGPCKMVAPILEKLSKDFAGALKVVKVDVDQSPMTAQRYSASSIPMLLFVRDGDVID
RVVGAQPEHVLRAAIEQQLA
Download sequence
Identical sequences M4ZX29
WP_015439994.1.75388 gi|470176640|ref|YP_007562684.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]