SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|470176676|ref|YP_007562720.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470176676|ref|YP_007562720.1|
Domain Number 1 Region: 448-567
Classification Level Classification E-value
Superfamily Sortase 0.00000000196
Family Sortase 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|470176676|ref|YP_007562720.1|
Sequence length 606
Comment hypothetical protein YM304_04680 [Ilumatobacter coccineus YM16-304]
Sequence
MADQSADGRGALTTPLGRRTFIAGATGAVAGAALLPRTSAAATPDFSSFQVVTPTRLVDT
RPQMGDFGYTRVDSKVIRVQVTGRDITGSDDPVPADASAAVFTLVGINRSAAGNYLSAYP
TGTAWPGTANLNMSGNGDVSPNLVTVKLGTGGAVDVLSNQNSDIVLDLVGVYVPTGGDPV
RAGRYKLLPTPKRALDTRNTSKPGADAVVRVDLSSLRDQGIIDADAQAVSANITATQANR
GFIAAYPFGTENPGTSTLNVAQDATRGIGTMVKLGVENGRLGFNLYLQSGAHVIVDVAGF
MTGESASRSTTGQFVPIEPARLLDTRRGDGGKKRLWPKWTRAFTLPAEYASQASAIAMNL
AVTRTMGRGYFTLLGAQMRREEVSNLNVTGPNQTLSNHAITAVSTKGVECYSSAGGDVIC
DVVGWYKATSAGPSQPDLDFPPADPDPPAAPTPYYINVPRLNLGRNVLSGESEPVVDTGH
FWHWTGTGLVGQGHAIATFAHRTEAQGPLRQIHTMVPGDQVALFTGDQRKYTYEYFDRVV
TSKDPDEILASTQFRNNEETLAIVACTVGFDASKSAYPDKWAPTSLEWRIIVRLRYVRWE
DVIPTT
Download sequence
Identical sequences M4ZWB3
gi|470176676|ref|YP_007562720.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]