SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|470176969|ref|YP_007563013.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470176969|ref|YP_007563013.1|
Domain Number 1 Region: 546-792
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.1e-29
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.013
Further Details:      
 
Domain Number 2 Region: 154-378
Classification Level Classification E-value
Superfamily Sialidases 9.61e-29
Family Sialidases (neuraminidases) 0.029
Further Details:      
 
Domain Number 3 Region: 937-1034
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000206
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 4 Region: 388-558
Classification Level Classification E-value
Superfamily Sialidases 0.0000000135
Family Sialidases (neuraminidases) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|470176969|ref|YP_007563013.1|
Sequence length 1431
Comment hypothetical protein YM304_07610 [Ilumatobacter coccineus YM16-304]
Sequence
MRSVNGTAVRRATAIGAAFALLGVYQWAGGGQFGPTAESVDPNRPTPRGGQVENELGDRL
IRDDEFYRQRAYPNDEVPPGALEDAWAEAALLPVVAETRSLPTADEVVATDPLSPDSLSG
PDAFGLPASATWSQVGTRGITGYTNPFDDFYNGTVPLSGRIVAIANHPIDPNTAYIGSPS
GGLFKTTNGGTSWTPLFDSQTTLSISAIAIDPDAPDTLYVGTGEGSGGRYYGQGVFKSTN
GGATWTKLSIGSPGTALDYCHVSDVVALPGNDRVIVTVSSATFGGPASSCQTSGTFAATG
LWTSPDGGMNWSHTVTDGATDLAVDADDPTRIYAGDRQFGALYSINSGDDWSTTGGLPGS
DRGQAKVAAGDGDVVYAAIEKASDFSLLGIYKSTDGGINYSLLSAPADICNYPQLPGDPL
TAQCNYDFDIAVDTSPAGDDIVYLAGIFLGRSTDGGVTFSYSGNDPNEEFGSKQLHVDIQ
KLSFDASGRLWVGTDGGIQRTSNGTTFTNVNADLNLQQFQHGVSTTPDGTLFGGTQDLGS
TRYTTGPGWTMWLSGDGGAGAVDPRDPQVVYGTYIYGQAFKSFDGGANSFPLNEPDCMGE
GTSACLFYAPFEMDPARPDTLLTATDRVYRTTDAGETAPFPISAAFSNPISAIAPAASDE
NVIYAGDIGGELRVTSDAGITNTWPVVSSSLPARWITDILVDPRDADHAWVAFSGFGSGH
VYETYDRGGFWFDVSGDLPDAPVNAIDADFRTSPANVFVGTDVGVFASDDGGANWARYGT
GLPQITTLDVVVNSAQNTLTAGTSGRGMWTVPIGCSVPTNDLFANATTLTGHSDSDVGDN
TCASTEFGEPRHNPDSGDPLPSNSLWWNWTSPGNGTVEIDTFGSAADTLLSVYSGDSIGS
LTQLAHNDDTGSELQSQVELPVTEGTTYRIAVDGYDTFDTGSVTVNLDATVSPSAPLNAT
TTPGNGEVTVSWDAASANGSPVIAYGVSASPGTGSCGTAGDTSCTIDGLTNGTEYTFSIT
ASNANGTSNAATVTGTPGTEVIVALAPGRVYETRSAPNVTVDGQQTAVGRTTAGEVVEVE
VAGRAGVPNDADAAVLNITAIRPTTGGFITSFPCGTTQPLTASLNYAAGQVIANGAIIKL
GTTGTNTGKVCIYTSSAMDLVVDVTGYVPDGSVLGALAPGRVYETRSAPNVTVDGQQTAV
GRTAAGGVVEVEIAGRAGVPNGADSAIINITAIRPTTGGFITSFPCGTTQPLTASLNYAA
GQVIANGAIIKLGTTGTNTGKVCIYTSSAMDLVVDVTGYIPVTTGFGALSPGRIYETRSA
PNVTVDGQQTALGRTTAGEIVEVDVAGRAGVPNDANAAVLNITAIRPTTGGFITSFPCGT
TQPLTASLNYAAGQVIANGAIIKLGTTTGKVCIYTSSAMDLVVDVTGYVSG
Download sequence
Identical sequences M5AI14
WP_015440323.1.75388 gi|470176969|ref|YP_007563013.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]