SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|470177141|ref|YP_007563185.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470177141|ref|YP_007563185.1|
Domain Number 1 Region: 133-254
Classification Level Classification E-value
Superfamily Sortase 3.14e-28
Family Sortase 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|470177141|ref|YP_007563185.1|
Sequence length 259
Comment peptidase C60 family protein [Ilumatobacter coccineus YM16-304]
Sequence
MKGLRTRTESTESEGSRRRALMIGAPVAVVALAIGGVVFAMQSDGDSIKTAEASDLTTTT
VATTTTEASAEVFSEAEVTTQPAPTTTPTTSTTSTTSTTTTTSTTVPPSTLPEQPDVPIA
PPADPRGYEDQIQLGGISIPKLGVDEPLLEGIRLTTLDNGPGHWPGTAMPGEVGNVVVAA
HRTSHGGPFRHIDTLVAGDVVNFTVDGEVIEYTVTGTQIVNPDAIWIVDPTDTPTATLFA
CHPPGSVAQRIVVNLALSE
Download sequence
Identical sequences M4ZXM2
gi|470177141|ref|YP_007563185.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]