SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|470177166|ref|YP_007563210.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470177166|ref|YP_007563210.1|
Domain Number 1 Region: 684-788
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000251
Family Cadherin 0.0026
Further Details:      
 
Domain Number 2 Region: 584-683
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000989
Family Cadherin 0.0029
Further Details:      
 
Weak hits

Sequence:  gi|470177166|ref|YP_007563210.1|
Domain Number - Region: 1723-1758,1808-2151
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00301
Family Galacturonase 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|470177166|ref|YP_007563210.1|
Sequence length 2282
Comment hypothetical protein YM304_09580 [Ilumatobacter coccineus YM16-304]
Sequence
MLAPGRSDRAVGRSAVNVRSRWSNLVVTALVGAAVVVIPVASASAAPTGVEPSSSAVSEA
AAQTAETIVVAERARFAETRTGLTTFDGESNGIGRLAAGDTIEIEVAGRGEIPADAAAAL
VYVTAVRPESTGYLTIFDCAEPRPLASSLNYVPSLPVGNEIVAALSDTGSLCVFSFASTD
LTIDVGGFVPAASPLVSFAPRRIVDTRDGSTTYDGEAQGGGRTTPGEPVTVDIAGRIGIP
EGVDSVLANIAAVRPDGPGNLVAHPCLATPPTASSLNYVTDTTRANELLLDVDGNGNVCV
ETTTSVDLVIDVVGYVPTGTNLRNQPPVRLVDTRDIGDTIDGTFEGEGRRLGDTEYRVRV
AGRGGIPAGASAALLNLVVVQPDGFGYATVHPCEEQRPVVASMNYSPGVTGANEIFAEFD
AAGDVCIYTSSGAHLVVDGSGYVAPINVGVDETDLSISASSAPDPVDAGEPLTYTVAVTN
NSSVAATGVAGLVTLPSGVVFRTTTGCIEDPSGAPSCTIGELAAGATVTYEIDVDVDAAA
AGTLVANFSVLSDQVDSEPSDNATAVSTAVDALVVDDPPVITAPVSSALSVSENSTLVVD
VEASDPEGDVEGAGLSYSLSGPDQGLFAIDGSGVLSFVSAPDFEAPGDSGGDNGYSVTVT
VTDSGALTDSRALSVNVTDVNEAPTVTAPVSSTVSVSENSSLVVDVEASDPEGDVEGAGL
SYSLSGPDQGLFAIDGSGVLSFVSAPDFEAPGDSGGDNGYSVTVTVTDSGALTDSRALSV
NVTDVNEAPIVTTTAGSTSFTEGDSPTVVDGGVSVSDPDGDLLDAATVTISAGFETSVDT
LSASASGGIVAGDISYAPTTGVLTIDPATAQSAADFQAVLRTVTFANASSTPSTANRTIT
FSVDDGALASAGADKIVNVSGVNFDPVPTNATISYNAIGNTLLRVDGADADDHDTPVAGR
VASTTDTTDALAKAAPTDADSAVVTYVAGTFTTVEGGTIVLDDDGDFTYLPAAGFEGADS
YAATLTDGDGGTANVTIELTVADMVWYVEDTVHATKNPAGGDGRSTDAFETLAGAEAASG
PGDYILVFETDAPLDGSIELQDGQKLFGQAVEEESPSRLPAGLMLEEIADTNARPFIDNS
AGDAITIAASAGAVEGVEIRHLRIEGQGDAIDVRPTGTASVRVAFSDLELSGATGAGLSV
SGAATSGIVTVSEVESVDVASAGAGGLLFDTVTFDADDVTIGVQTVEAGDSSIGDPATPA
DIVGDGLRLNDVSGSIDFGTLDIGNTDGTGLYVRDAGGKAGAFQLDTDAGTINTVNGAAV
DIDPVALGLGAGDGMVLTSVTALNSGPGTTAHGINLDTVSGAFTVTGDTSLTRTGGELTN
GIVIVDSSAEISFDGEVDVVADTGAAISIDTQTTDVGFGPTQVEAQTGVSIVGSPSITTT
FDSLDVVAANGTGIVTDDAGTLEILGTASTVAVTAGTAIDVTDTELSGAGSSPANFATVT
STAGTGSAIALTRMSGALAIAAGSVTSGSAPTVDLEAVSGDVSYGGDVTGGTGRAIEIIN
SHAPGVATFDFSGDITTVSGAGIYLYTNEGSGSTSIASFTGTLTLSTGGSDAFVAAAAGS
VVVTDPANANSITTTGGTAISMVNTDIGAAGMKFTTVSATNAVSGIRLTNAGTGPFVVTG
GAIVNASYRGLDISGGNGNVTMGASINTTSTGRSVEATTHTGGTITLAGAIDDNGIGIRL
ASNIGATITFTGGVDVDTSLAAGTLPGLTASSGGTLTILGPNNSIDTTASTGTALEVVSG
TTIGAAGLTFRSVSASGGVHGIELADTGTSGGVTITGDGSNLANGSGGTISATTGSAIEL
SETADFSATSMDVSADNAAPGVQRGVNASQLTGTNIIRASTFGGFAEENAFAVRVVNSSG
TLDRFTVDASSFTGTSTGSRGGAVSFELTGSAGGRIEIVNGTTFDGIKDEALGLSMNGTG
STELYVADSVFSDDSGIAQLAGGRASGVSLLTGDSAALDVEFRSNIFREIGAQTGFGGTT
STAMTLRANGSSAMNTEFSSNTIQNVDVDGLLAVIGAESSTGRHLFADNTVTSVARHALW
YSFSGTSGPNDVTIRDNVMTSMATASSFDAVTVITGSDVDVVDVSLTNNTIEVPSQASIP
ARLDFSNATANATLHGNTMRALHAVSSEAYRVSASGPSTALCLDMNGANAGADRNTAQAN
GGLDGFLATANSSSIALVGLSTPTEAAAEAHLLNTNDHANATVIASGTFTAGPTTCPTPT
LP
Download sequence
Identical sequences M4ZXP4
gi|470177166|ref|YP_007563210.1| WP_015440519.1.75388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]