SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|470177385|ref|YP_007563429.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470177385|ref|YP_007563429.1|
Domain Number 1 Region: 5-119
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 6.67e-22
Family Thiamin pyrophosphokinase, catalytic domain 0.0072
Further Details:      
 
Domain Number 2 Region: 150-210
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.0000129
Family Thiamin pyrophosphokinase, substrate-binding domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|470177385|ref|YP_007563429.1|
Sequence length 221
Comment putative thiamine pyrophosphokinase [Ilumatobacter coccineus YM16-304]
Sequence
MNDHIVIVTGATPIPERVAALVPDAAIVLGVDSGFDHALAAGLRPNGLIGDLDSVSDDGR
AWAEEHATISRHPADKNETDTELAVAFAAGMAPAWLTMIGGGDRLDHTIAAIGSLAAPAA
TSIPRIDAWWNGQHIEVMHGPSRRTLSLTPESTLSLLVLGRPCDGVSISGVRWPLDGIRL
EPVVGLGVSNEVTDAAGDVSISISSGVLSVFDHPLVESTTD
Download sequence
Identical sequences M4ZZA6
gi|470177385|ref|YP_007563429.1| WP_015440738.1.75388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]