SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|470177913|ref|YP_007563957.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|470177913|ref|YP_007563957.1|
Domain Number - Region: 362-408
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0335
Family Di-heme elbow motif 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|470177913|ref|YP_007563957.1|
Sequence length 415
Comment hypothetical protein YM304_17050 [Ilumatobacter coccineus YM16-304]
Sequence
MSASTTITPSTTPTPVSSTGDELAALGWEINANQYRLVHLAARFDDELEWFRLGYPSASS
WIAAKLQIQTSTAREWIRVGQALRHLPSIDAAFAVQMISYAKVRILTRWADDDNEEHLLE
LAHERAAGRLTVAIAKFLADEGETDAERDLRLHDERSFTTWTDADGSTVLRIVLPPSVAK
PVVAAVDELVRRIAMTPLEGGPAEQPAPGDGASESAPDASADASDEQSVVESSPKAASMV
EAAPGPGISPDPLSVTLRDMRRRWQPDGRDDWTFPSLGQQRADAFVALYLGSGVSLTTEV
VVHVRGDGITFDDGTPTTSSAVLRQLDDSFIRLMIHDAQRRPVDASGRRRHPTTRQQRVV
METHGHECVDCQRTELLELDHNPPFERTRRTVTHELEPRCAPCHRARHRHDLGAA
Download sequence
Identical sequences M5A0H6
gi|470177913|ref|YP_007563957.1| WP_015441266.1.75388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]