SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|470180027|ref|YP_007566071.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470180027|ref|YP_007566071.1|
Domain Number 1 Region: 367-433
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000497
Family NfeD domain-like 0.0041
Further Details:      
 
Domain Number 2 Region: 30-141
Classification Level Classification E-value
Superfamily ClpP/crotonase 0.00000467
Family Crotonase-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|470180027|ref|YP_007566071.1|
Sequence length 456
Comment hypothetical protein YM304_38190 [Ilumatobacter coccineus YM16-304]
Sequence
MRRLAITVLASLAALSLFGSPAGAQSDDTEPDLSVDVLQVSGLFDDILVDSVNDAIERAD
DDGAQALILQINSRGTVVSDDVIEQLLVDVAEAPVPVAIWVGPNGARLYGTAAQLLTVVD
ASGMAPGARVGYAGVPLTPTGASGPIDAGFDGAAQDALRNGSLGLSEARALDIFTEINDE
GVPTITSMVQVLDGRELDGNVVETTEFVVLENGQGRNDTTATVRFAKLDLVQQLFHTVAS
PPVAYLFLLTGLALLIFEFYTAGVGLAGVIGAVCVVLACTGLAVLPTRTWALVVLIGAMV
AFAIDVQVGIPRFWTGVGIVGTIISSLFLFESLPGNSLRPSWIALLTGIGGITLTFIVGM
PNMVRTRFATPTIGREWMIGEEGKVITDVDPDGVVEVGEGRWRARTNRATPVVAGDVVRV
AAIDGVTLEVEPLEGAAKDYREMRKKDDAESAPAES
Download sequence
Identical sequences M5A5R3
WP_015443380.1.75388 gi|470180027|ref|YP_007566071.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]