SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|470180122|ref|YP_007566166.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|470180122|ref|YP_007566166.1|
Domain Number - Region: 709-802
Classification Level Classification E-value
Superfamily Cadherin-like 0.0104
Family Cadherin 0.017
Further Details:      
 
Domain Number - Region: 36-119,214-355
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0259
Family Quinoprotein alcohol dehydrogenase-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|470180122|ref|YP_007566166.1|
Sequence length 1612
Comment hypothetical protein YM304_39140 [Ilumatobacter coccineus YM16-304]
Sequence
MPMTSTPSTVTWKQVVAAMVATVMCLSALVVVFRSDGLPAVDAASSRATRWFVHEPSGRA
VLVDGFGGRALASREAGVPGDDLFVAEGGGQAYLLNDTTGEVRSIDTAELRLGPPQGLAS
LGSGLAIARSGASGLLVANPLAGEATLSPAGADSVEIAFDADQIAGVETFGTIALGPDGS
VWTLVDGTLDRATSASTTSEDLGIAGGPDGGSLSLVGNLPLVLDREGRRVRLGGGSWQEL
PTQIDGSEIVLQQPGPQHSCGWVGADDDLWCVSEDGIEVSSTVPGLDVDGSSLLGIAGDA
AALVRRGPTQVVQFDWRSQEILDSQPATVLSDAVLNVTVTTDIVWVDDTNGDFVWTVHPW
GIQRVNKNDASLLVLGADGDVVQDGDSAKGDSAGADDGVSTTPDLLEADNNGTDDPPRAV
DDQVTARSGNSVPIAVTANDYDPDGEAIAIVDVATPGHGLVEIGTASTIVFTPDAGYVGL
DQFEYTIADGDGTRASATVSVELLPPGATNQSPIGAPDTAQTGPGRPVVVEVLLNDVDPE
RDSLRIDTFLPPASGGDVAIVEGPSGAPALQFTPTNGFEGTATFSYRPIDTFEAVGEDVE
VRVEVARLGDDNRPPVVRPDAVRTRRNTETPLPVLVNDKDPDGDPLSLSVVRPLPDGLDV
VVQGEQLGITARAGAADQVPFQYEVDDGNGNVVRGAVLVVVIDDIEPNRPPVVSPDIETA
VVGQTILIDVTANDSDPDGDPLAVVATSQPEGRGTVALAGRNQVEFIAAAFDDEEESNAR
FTYTVSDGNGHEVVGDVTVTVLAQALPEPPYAQDDSTFTFMNEPVTIDVLRNDGDPSGER
PTLIGRPGCPGGGVATVTADSQVRYDPPANGTGAYRCTYEVTNTQGLRDSAAIIISVREP
EVTNEPPRALDDLVFVEVNDSIPVDVSANDTDPDGSDLALKVTSSTRPIVGSAVRNGNVI
TYTAGPNVGTATIEYQIEDEGGAIATGFMQVRITEVQNLAPVARIDTRTIPGPGVPTTID
LLDNDSDPDDTPGGLTLETASLTSGGGTLSLVGGGVVQISPAPDFVGAITGVYSISDGDG
LTSSSSFTLNVLEPINRAPLAADDAASVVNGGSVTTPVLFNDSDPDGDSLSLSIIGGPDP
ALGSASVTGDQSISFSATPGQSGVAIVNYQVSDGELTDTASLRISIASCAQSAPTAGDAF
LETGYQQPIAINLANYASNGTVTEVNGPPTYQNGTYTPPAGTNGNITITYAVVNDCRQRA
TGTITVDVNQDPVGQNQSVTLGRGEVREIPVGAIASDDEGLIISGSSGAPGWVTTGPDRV
VIAPTQAVADGAYSWSVTVTDPGGLTATVGLTAVVTNEGPRAEPDTIDVSGGAATVDIVA
NDSDPDGPNSALRVQSVPSSITFTNGSTGTVALQPDGRSIRVTPGSGRGQATFQYTIVDG
SGALSAAATVTVNGQAVNRPPVAIDKTVSVLVGIPTPILLEANDPDGDSFTVENLNDPSG
MVVLGPIGLIIDVLALEVGTFNVTFNVVDSHGAVSGTATVTINASFPLVTTTTTTTTTTT
VPVDTTTTTVPVDTTTTTTSSTTTTTVAPTTTTTTTTTTVAPTTTAPPDPGG
Download sequence
Identical sequences M5A5Z5
gi|470180122|ref|YP_007566166.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]