SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|470180148|ref|YP_007566192.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470180148|ref|YP_007566192.1|
Domain Number 1 Region: 880-976
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000408
Family Cadherin 0.006
Further Details:      
 
Domain Number 2 Region: 774-871
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000518
Family Cadherin 0.0035
Further Details:      
 
Domain Number 3 Region: 678-763
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000127
Family Cadherin 0.0058
Further Details:      
 
Weak hits

Sequence:  gi|470180148|ref|YP_007566192.1|
Domain Number - Region: 1210-1519
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00132
Family Pectin methylesterase 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|470180148|ref|YP_007566192.1|
Sequence length 2051
Comment hypothetical protein YM304_39400 [Ilumatobacter coccineus YM16-304]
Sequence
MNPSIRNAIRTALAATLTVSAVATSAGQASAEPVADDALVVFANSTTEETLVSLAPSRFA
DTRLDGTTIDGESQATGLIDAGETIEVVIGGRGSVPADATSAVMNLTAVTPTGNGYITAY
DCDLDRPLTASLNFATGVNVGNEVVTALSGTGSLCLYASTATHLTVDVAGYVPATSSIEP
IAPWRLLDTRPTGTTVDGVSQGDGRTTPGVSTVVRVAGRAGIPEAADAVIANVIAVRPTA
TGFVSAHPCLDPAPSTASLNYVADVNRGNELLLDLDGNGDVCIETSTEVDLVLDVVAYIP
AGTNLKTTSPVRLADTRLSGETVDGEYEADGRLGAGDEYTIRIAGRGGVPADARSGVLNL
AVVNPSGNGYVTMHPCQDPRPVAASANFTAGVTGANELLAELDENGDVCVFTSAAADLVV
DASGFLAELPAGPGEADLSIAVTDSADPVAAGDSLSYTITVDNAGPDDATGVTVMETLPA
GVTFDSTTGCGEDPNGVVSCTLGTIATGDSASFTVDVTVDASTSGVITNQAAVSSDLTDP
DTSDNVVSETTTVDGLGTINIVKLSDPSGGTGYAFTDDIAAPNSFSLDDTETKTFTDVAI
GTYVVTEVDPSPQTLTAIVCDDGTSTTPSTVDVGTRTATIEVDPGENVTCTFSNNRNLAP
TITTAATANAAENQTAAVDVDTTDDFSSEGAGLTYSITGGADAAAFSIDAATGALTFDAA
PDFESPADTGADGTYDVQVTVTDAGPGTPLTDVLDLAITVTDVSEAPSITTVATALAAEN
QTVVTDVQSTDPEGDTEGSGLTYSITGGADQGDFSIVAATGVLTFDSAPDFDTPGDTNAD
NVYEVQITVTDSDSMTDVQDLAVTVTDVNEAPTITSGSAVSAAENQTAVTDVQSTDPEGD
TEGSGLTYSITGGADQGDFSIVAATGVLTFDSAPDFDTPGDTNADNVYEVQITVTDSGSL
TDVQNLAVTVTNINEAPVVTTTAGTTAFTEDGGAVVVDAGVTVTDPDSTVLDTATVTITN
LQDGASEVLAATATGGIVAGDISYAAGVLTIDPATGQSLADFQAVLRSVTYTNANNTPDT
TARVVRFVVNDGAIDSADADKTVSVTAANDAPTLTAPGTYASIGNVGIDVPASAGLIQGA
TITDVDYSGAFTIGGTVPTTSAQGGGVAVNPNSGGFVYEPPAGFTGNDTFTYQVCDGGTP
APSACSTAATVTIAVSAPIWFIDDAAAAGGDGTRVAPFKTIGQFNAAGGPAANHGVFLAD
GTYTDGIVLADGQRVIGEGTTGTTLAGALGITTPTHSETLPSLDGTSPTISSTTADGIAL
AEDNTVRGLDVANTPAGHALAGTVVGTLTASEIDVSGTGGIIEVATSGNLDAVSLDTQVS
TSTISGASAIDLNGLTGTTGYSGGIVSISGASGSAIEITGATAPVAFAYATINGGQKGVE
LTNNSATFYMAGAIGGSGSTTQEAVDIDGGSGNATFTTAISNSQGRAVDINGRTGGVITF
TGSIDDTGGAGVALTNNSGSSQITFTEYVHLTNSTGTAVTATSNSGATISFADLDVTNTT
SNQTGLLVSNSGTFSTTSGTINTGQATAVDLDNTNLGVVLDSVTSTGGSAVGIDIRNTTG
TFTVNGDGASGPGITANNGSGGTIHTKTGDAIYLDTATGISLNYLDIGAAGALGNIDGNG
VRANAVAGLTITRSDFLNVADQTSPDEAAVMVTAPTGAYTIANTSFDRSHDDHVRITNAN
GNLASLSVTDSRFTDNNDSGQGNDSLLYLGDNSSDATIVVAGNTFEDSDGDHVQVSLNGS
ASADVTIGGPLGTDGNTMQVNGGETVVGSGITLSAGNSYSGSLTYSIENNSIQGAVGRAI
NVNLESSTSDGSFDGDITNNVVGTPGTPGSGGYGVGVISNGAGTSTVDLTGNSVRSWTES
GISLEARNGSNRLNATLENNTILEGADDIFYFAGLFVASGALATDTTAVCLDVGMSGGNN
TFDQMPDPTFSFGDAYIGTLGSSTIAISGYVGAPNDAAAIQSDIASDNVGNPSVDVSASG
GDISGGGACAV
Download sequence
Identical sequences M5A734
gi|470180148|ref|YP_007566192.1| WP_015443501.1.75388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]