SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|470180168|ref|YP_007566212.1| from Ilumatobacter coccineus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470180168|ref|YP_007566212.1|
Domain Number 1 Region: 80-217
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.8e-24
Family GntR ligand-binding domain-like 0.01
Further Details:      
 
Domain Number 2 Region: 8-101
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.48e-18
Family GntR-like transcriptional regulators 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|470180168|ref|YP_007566212.1|
Sequence length 227
Comment putative GntR family transcriptional regulator [Ilumatobacter coccineus YM16-304]
Sequence
MTAKPTESHDHVAVAMASLRSAIANGKYPPGRRLKEVEIAESLDMSRTPVREAIRRLVGE
GLLELTPNRGAAVPQWSDRDLDEMFEVRAQLEGFAARLAAARATPEEVTSLRELCDRMER
FGGHDLRAEDWNEYAVINNQFHRDLLRGSDNRRLETAALGLMAPSLLHNQIARQSTALLD
RSNQHHAEIVDAIAAGDESWAEAITRTHVVATRNKFIAARGDDAVAP
Download sequence
Identical sequences M5A753
gi|470180168|ref|YP_007566212.1| WP_015443521.1.75388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]