SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA000025-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA000025-PA
Domain Number 1 Region: 40-63
Classification Level Classification E-value
Superfamily DPY module 0.00000262
Family DPY module 0.0015
Further Details:      
 
Domain Number 2 Region: 144-166
Classification Level Classification E-value
Superfamily DPY module 0.0000235
Family DPY module 0.0018
Further Details:      
 
Domain Number 3 Region: 168-190
Classification Level Classification E-value
Superfamily DPY module 0.0000275
Family DPY module 0.0015
Further Details:      
 
Domain Number 4 Region: 307-328
Classification Level Classification E-value
Superfamily DPY module 0.000034
Family DPY module 0.0023
Further Details:      
 
Weak hits

Sequence:  MESCA000025-PA
Domain Number - Region: 244-265
Classification Level Classification E-value
Superfamily DPY module 0.000209
Family DPY module 0.0021
Further Details:      
 
Domain Number - Region: 3-43
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0054
Family EGF-like domain of nidogen-1 0.079
Further Details:      
 
Domain Number - Region: 61-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0177
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 103-137
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0242
Family EGF-type module 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MESCA000025-PA
Sequence length 437
Comment pep:novel scaffold:Msca1:scaffold42664:17:5689:1 gene:MESCA000025 transcript:MESCA000025-RA description:""
Sequence
ETTLCNPNPCGVNSECFVKGNSYSCKCIRDYIGNPFEECRPECVENSQCLANKACINSKC
LDPCATSPCGIDSECYVNNHIPVCVCIKGYTGDAFKQCTGITVRENDCDGNICGPNAQCK
IVNGRGICECLSGFFGDPYNIGCKPECVISSDCPKNKLCLKSKCRNTPGCVSNDDCTDNE
ACINNKCRDPCNCANNSQCQVKNHRAICSCEPGFEECYMEQNRPLCRCKSGYRGNPFVEC
KIIECLTNSDCPTNKQCSNEKCINPCIYNNKCGAKAECFVQNHKDICRCPQGYYGNPFVK
CMQNTEECVIDSDCPESLACINARCVNPCHQLEPCSRPSTCAVISSKPMRTMICTCPDGY
VSSGSGTCKPTKSIVEIGCISDVDCDSTKTCVAGICKNPCDSNACGSNAECRIKAINLFA
LVPKDMKEIQKLDVSVF
Download sequence
Identical sequences T1G9Y3
MESCA000025-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]