SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA000108-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA000108-PA
Domain Number 1 Region: 3-43
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000283
Family EGF-type module 0.021
Further Details:      
 
Domain Number 2 Region: 93-136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000802
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  MESCA000108-PA
Domain Number - Region: 41-102
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0252
Family Complement control module/SCR domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MESCA000108-PA
Sequence length 216
Comment pep:novel scaffold:Msca1:scaffold37365:4275:8075:1 gene:MESCA000108 transcript:MESCA000108-RA description:""
Sequence
IATCNPPCQNNGICLEPGLCKCPDNYQGPLCQHKKVVCPSKPPVPKNSKVSCRDTNCNVE
CIKGYKFPDGSGITNIGCVDGQWQHTKTGQSVVPDCEPICDPPCQNSGTCVGFNVCQCSQ
KYKGPRCEYDYKICNITKAGFNGNFRCSYDSEQAKCTINCPETINFDIAPATEYTCKYSE
GVFKPSPMPKCVYRKFNLFHYNFTKQYISCSVHVFG
Download sequence
Identical sequences T1GA61
MESCA000108-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]