SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA000265-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA000265-PA
Domain Number 1 Region: 263-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000838
Family EGF-type module 0.012
Further Details:      
 
Domain Number 2 Region: 229-262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000271
Family EGF-type module 0.016
Further Details:      
 
Domain Number 3 Region: 127-176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000519
Family EGF-type module 0.027
Further Details:      
 
Weak hits

Sequence:  MESCA000265-PA
Domain Number - Region: 174-203
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00014
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 93-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00181
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 311-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0193
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 210-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0212
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MESCA000265-PA
Sequence length 339
Comment pep:novel scaffold:Msca1:scaffold47453:4245:5488:-1 gene:MESCA000265 transcript:MESCA000265-RA description:""
Sequence
MNKFGLDTGIGGNGTYLLKANIFRSSDISIIHPLKQNINATNPCSKEPCRSQKAVCILSS
ESATGFSCKCSSELLMTTIENNKQECRPPAVDYCPLKCNLGVCKVINHVPQCVCQPMYEG
EHCEHYRCSEYCLNGGVCAPLSIPLNPNSNEPIPLKCTCKPGWSGARCEISILECQKRCH
NGGSCIIKSDGMKCSCPAKFNGDKQTVRGSPICDCADGFQGKSCELNMCDNYCKNGGSCV
LNHSGPKCDCPRGFEGDHCEFSCSDYCLNGGTCDMHMDNLLCKCPSRFIGNRCQTDICLT
MNPPASCAITSSCQELTCKNQGTCHVVNGSAICNCTGSW
Download sequence
Identical sequences T1GAK7
MESCA000265-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]