SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA000437-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA000437-PA
Domain Number 1 Region: 161-285
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000012
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 2 Region: 92-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000183
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 3 Region: 293-323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000322
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 36-72
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000616
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  MESCA000437-PA
Domain Number - Region: 142-169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0335
Family EGF-type module 0.0066
Further Details:      
 
Domain Number - Region: 74-92
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0375
Family EGF-type module 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MESCA000437-PA
Sequence length 330
Comment pep:novel scaffold:Msca1:scaffold2606:5084:13404:1 gene:MESCA000437 transcript:MESCA000437-RA description:""
Sequence
MVYPGCKHGSCNGTAWNCVCDTNWGGLLCDQDLNYCGTHEPCLHGGTCENTAPDSYRCTC
AEGLSGKRCQIVEHPCATQPCKNSGTCTLKVNIDECAGGPCEHGGTCIDLIGGFRCECPP
EWTGDVCQLDVDECDSNPASKLGPCINAQSCNNTLGAFECTCLDGWGGQTCAKDLDDCVG
QCKNGATCIDLVNDYHCACETGFTGRDCETNIDECANSPCRNGGECVDLIGNFKCICPVG
YSGSLCEEAKDHCTPSPCLHGTCLNTPGGYYCHCPQGRSGQHCELAKAITNGLNECSPNP
CRHGGICMDGDGDFTCECTAGWTVEKKEIY
Download sequence
Identical sequences T1GB17
MESCA000437-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]