SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA000712-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA000712-PA
Domain Number 1 Region: 145-250
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000000000131
Family YWTD domain 0.00071
Further Details:      
 
Domain Number 2 Region: 71-123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000147
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MESCA000712-PA
Sequence length 250
Comment pep:novel scaffold:Msca1:scaffold7743:17182:17934:-1 gene:MESCA000712 transcript:MESCA000712-RA description:""
Sequence
MIVRGQQVPSPARLALFENRIVWTDATKQGIMSVDKFDGPSSIEVIYKAKDIRDPKAIVA
IHPLAQPKVSNPCGATNGGCNHMCIVTAVKGAGLGYRCACHTGYQLQSDLKSCRLVKEFL
MYSQQRFIKGKVLEPIIEGFSDAILPVVSRRARFVGLDFDSRDEYIYYSDVLQDVIYRVH
RNGTGREIVLASQNEGVEGLAVDWASKNLYYIDSRKGTLNVLSTRNVTNRRTLLKNLKRP
RAIVVHPNKG
Download sequence
Identical sequences T1GBS4
MESCA000712-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]