SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA001312-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA001312-PA
Domain Number 1 Region: 422-469
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000977
Family Laminin-type module 0.001
Further Details:      
 
Domain Number 2 Region: 313-365
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000159
Family Laminin-type module 0.0029
Further Details:      
 
Domain Number 3 Region: 474-522
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000419
Family Laminin-type module 0.005
Further Details:      
 
Domain Number 4 Region: 373-424
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000067
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 5 Region: 235-285
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000215
Family Laminin-type module 0.009
Further Details:      
 
Domain Number 6 Region: 525-573
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000614
Family Laminin-type module 0.0094
Further Details:      
 
Weak hits

Sequence:  MESCA001312-PA
Domain Number - Region: 2-28
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000128
Family Laminin-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MESCA001312-PA
Sequence length 574
Comment pep:novel scaffold:Msca1:scaffold9589:2264:6223:-1 gene:MESCA001312 transcript:MESCA001312-RA description:""
Sequence
MCDVVTGQCRCRENMSGRRCESPIQKHYIPFIPIIHEAEAPGTQCFGYMNHNCSRYEQNK
DYMVIQSGSEVEFTVDDIPKTMTYDVQIKYMTQSPGQISDTYITLIRPETYEYSSESAIC
SPNEPQYEQRVPLNLPDNQRQVVALSDVCLEKGKTYRVRLHFERFRGPQDENSGVILVDS
LNIIPKIIPENHVFPNEIFGKIYQERHCQYDSTDPTCADMNKHIALVIRNGSVSCDCDPT
GSLSKQCEDYGGSCSCKPNVVGRTCNVCAVGTYGFGPDGCKACDCNSIGAKDNNCDVLTV
STWILEFPNCMICNCNGHTNNCDALTGECLNCEHSTTGFNCDSCLEGFYGDPSWASDIGC
RPCRCPDTVASNHSHAVDCQLDRRNNNMQCICKEGYAGTKCEECADNYFGSPEIPGGSCE
LCDCNDNINPRDYGNCDAKTGTCLKCLYDTTGEHCEFCKDGFYGNALEKDCRPCECELLG
TNSTIKYCDRFTGHCPCLPNVIGMTCDSCIENHWKIASGEGCEHCDCDPTGSLREQCNPY
DGQCECRTGFGGRQCNQCQRDFWGDPNVECHACE
Download sequence
Identical sequences T1GDC8
MESCA001312-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]