SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MESCA001424-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA001424-PA
Domain Number 1 Region: 24-106
Classification Level Classification E-value
Superfamily Immunoglobulin 4.89e-20
Family I set domains 0.02
Further Details:      
 
Weak hits

Sequence:  MESCA001424-PA
Domain Number - Region: 121-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000712
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MESCA001424-PA
Sequence length 150
Comment pep:novel scaffold:Msca1:scaffold23787:4234:4854:-1 gene:MESCA001424 transcript:MESCA001424-RA description:""
Sequence
MNNFYILIFFTAQTASITSLTVINKTIHYGRDVRILCKVRGQPPPKITWFKDDKSINRDK
HLYSFNHTRRRSELTIKSFNSSDAGTYECRAKNKAGNIPVRRHITINLPLTPLSTRRPID
DGEPCDDHMSKMCLNGGTCKFDNKLRLAFC
Download sequence
Identical sequences T1GDN5
MESCA001424-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]